PDB entry 5vqn

View 5vqn on RCSB PDB site
Description: E119D mutant of 2009 H1N1 PA Endonuclease in complex with RO-7
Class: hydrolase/hydrolase inhibitor
Keywords: Nuclease Influenza Resistance Inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-05-09, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein
    Species: Influenza A virus [TaxId:641501]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S0 (20-72)
      • expression tag (17-19)
      • linker (70-72)
    • Uniprot C3W5S0 (73-End)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5vqna1, d5vqna2
  • Heterogens: MN, SO4, R07, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vqnA (A:)
    mgsshhhhhhssglvprgshmedfvrqcfnpmivelaekamkeygedpkietnkfaaict
    hlevcfmysdggskhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfid
    igvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrlftir
    qemasrslwdsfrqser
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vqnA (A:)
    gshmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrf
    eiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfidigvtrrevhiyylekan
    kiksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqse