PDB entry 5uq4

View 5uq4 on RCSB PDB site
Description: Crystal structure of Heme-Degrading Protein Rv3592 from Mycobacterium tuberculosis - heme free with cleaved protein
Class: oxidoreductase
Keywords: Structural Genomics, Center For Structural Genomics Of Infectious Disease, heme-degrading protein, Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE
Deposited on 2017-02-06, released 2017-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monooxygenase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: LH57_19585
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uq4a_
  • Chain 'B':
    Compound: monooxygenase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: LH57_19585
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6X7R2 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d5uq4b1, d5uq4b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5uq4A (A:)
snampvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthw
esdeafqawangpaiaahaghranpvatgasllefevvldvggtgkta

    Sequence, based on observed residues (ATOM records): (download) 
    >5uq4A (A:)
mpvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesd
eafqawangpaiaasllefevvldvg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5uq4B (B:)
snampvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthw
esdeafqawangpaiaahaghranpvatgasllefevvldvggtgkta

    Sequence, based on observed residues (ATOM records): (download) 
    >5uq4B (B:)
nampvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwe
sdeafqawangpaiagasllefevvldvgg