PDB entry 5uff

View 5uff on RCSB PDB site
Description: Crystal Structure of Variable Lymphocyte Receptor (VLR) RBC36 with Fucose(alpha-1-2)Lactose bound
Class: immune system
Keywords: variable lymphocyte receptors, VLR, leucine-rich repeat, LRR, adaptive immunity, immune system, sea lamprey, jawless fish, receptor, glycan binding, glycan receptor
Deposited on 2017-01-04, released 2017-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rbc36
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed):
    • PDB 5UFF (0-215)
    Domains in SCOPe 2.08: d5uffa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5uffA (A:)
    cpsqcscsgttvdcrskrhasvpagiptnaqilylhdnqitklepgvfdslinlkelylg
    snqlgalpvgvfdsltqltvldlgtnqltvlpsavfdrlvhlkelfmccnkltelprgie
    rlthlthlaldqnqlksiphgafdrlsslthaylfgnpwdcecrdimylrnwvadhtsia
    mrwdgkavndpdsakcagtntpvravteastspskc