Lineage for d5uffa_ (5uff A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435341Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2435342Protein automated matches [190787] (11 species)
    not a true protein
  7. 2435399Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (9 PDB entries)
  8. 2435424Domain d5uffa_: 5uff A: [345857]
    automated match to d5wk4a_
    complexed with 8b7

Details for d5uffa_

PDB Entry: 5uff (more details), 2.14 Å

PDB Description: crystal structure of variable lymphocyte receptor (vlr) rbc36 with fucose(alpha-1-2)lactose bound
PDB Compounds: (A:) rbc36

SCOPe Domain Sequences for d5uffa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uffa_ c.10.2.0 (A:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
cpsqcscsgttvdcrskrhasvpagiptnaqilylhdnqitklepgvfdslinlkelylg
snqlgalpvgvfdsltqltvldlgtnqltvlpsavfdrlvhlkelfmccnkltelprgie
rlthlthlaldqnqlksiphgafdrlsslthaylfgnpwdcecrdimylrnwvadhtsia
mrwdgkavndpdsakcagtntpvravteastspskc

SCOPe Domain Coordinates for d5uffa_:

Click to download the PDB-style file with coordinates for d5uffa_.
(The format of our PDB-style files is described here.)

Timeline for d5uffa_:

  • d5uffa_ is new in SCOPe 2.07-stable