PDB entry 5tca
View 5tca on RCSB PDB site
Description: Complement Factor D inhibited with JH3
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2016-09-14, released
2016-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated
2016-10-19, with a file datestamp of
2016-10-14.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.12
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: complement factor d
Species: Homo sapiens [TaxId:9606]
Gene: CFD, DF, PFD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5tcaa_ - Chain 'B':
Compound: complement factor d
Species: Homo sapiens [TaxId:9606]
Gene: CFD, DF, PFD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5tcab_ - Chain 'C':
Compound: complement factor d
Species: Homo sapiens [TaxId:9606]
Gene: CFD, DF, PFD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5tcac_ - Chain 'D':
Compound: complement factor d
Species: Homo sapiens [TaxId:9606]
Gene: CFD, DF, PFD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5tcad_ - Chain 'E':
Compound: complement factor d
Species: Homo sapiens [TaxId:9606]
Gene: CFD, DF, PFD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5tcae_ - Chain 'F':
Compound: complement factor d
Species: Homo sapiens [TaxId:9606]
Gene: CFD, DF, PFD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5tcaf_ - Chain 'G':
Compound: complement factor d
Species: Homo sapiens [TaxId:9606]
Gene: CFD, DF, PFD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5tcag_ - Heterogens: J55, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5tcaA (A:)
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5tcaB (B:)
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>5tcaC (C:)
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>5tcaD (D:)
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>5tcaE (E:)
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>5tcaF (F:)
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>5tcaG (G:)
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla