PDB entry 5t5d

View 5t5d on RCSB PDB site
Description: Crystal Structure of the PTS IIB protein associated with the fucose utilization operon from Streptococcus pneumoniae
Class: transport protein
Keywords: transport, TRANSPORT PROTEIN
Deposited on 2016-08-30, released 2016-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTS system, IIB component
    Species: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) [TaxId:170187]
    Gene: SP_2163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5t5da_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5t5dA (A:)
gshmassiefvriddrlvhgqvvttwlkkydieqviivndrisedktrqsilkisapvgl
kivffsvkrfvevlnsvpikkrtmliytnpkdvydsiegnlkleylnvgqmskteenekv
tggvalgeedkyyfkkivdkgtrveiqmvpndkvtmlekfl

    Sequence, based on observed residues (ATOM records): (download) 
    >5t5dA (A:)
siefvriddrlvhgqvvttwlkkydieqviivndrisedktrqsilkisapvglkivffs
vkrfvevlnsvpikkrtmliytnpkdvydsiegnlkleylnvgqmsekvtggvalgeedk
yyfkkivdkgtrveiqmvpndkvtmlekfl