PDB entry 5t2z
View 5t2z on RCSB PDB site
Description: Crystal Structure of Multi-drug Resistant HIV-1 Protease PR-S17 in Complex with Darunavir
Class: Hydrolase/Hydrolase inhibitor
Keywords: Protease, Hydrolase, inhibitor, Hydrolase-Hydrolase inhibitor complex
Deposited on
2016-08-24, released
2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated
2017-01-11, with a file datestamp of
2017-01-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot I7BFC3 (0-98)
- engineered mutation (45)
- engineered mutation (47)
- engineered mutation (66)
- engineered mutation (76)
- engineered mutation (81)
- engineered mutation (92)
- engineered mutation (94)
Domains in SCOPe 2.06: d5t2za_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot I7BFC3 (0-98)
- engineered mutation (45)
- engineered mutation (47)
- engineered mutation (66)
- engineered mutation (76)
- engineered mutation (81)
- engineered mutation (92)
- engineered mutation (94)
Domains in SCOPe 2.06: d5t2zb_ - Heterogens: 017, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5t2zA (A:)
pqitlwqrpivtikiggqlrealldtgaddtvledidlpgrwkpklivgiggfvkvrqye
qvpieiaghkvvgtvligptpsniigrnlmtqlgatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5t2zB (B:)
pqitlwqrpivtikiggqlrealldtgaddtvledidlpgrwkpklivgiggfvkvrqye
qvpieiaghkvvgtvligptpsniigrnlmtqlgatlnf