PDB entry 5t1d

View 5t1d on RCSB PDB site
Description: Crystal structure of EBV gHgL/gp42/E1D1 complex
Class: viral protein
Keywords: receptor binding, herpesvirus entry, Epstein-Barr Virus, membrane fusion, VIRAL PROTEIN
Deposited on 2016-08-18, released 2016-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein H
    Species: Epstein-Barr virus (strain B95-8) [TaxId:10377]
    Gene: gH, BXLF2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Envelope glycoprotein L
    Species: Epstein-Barr virus (strain B95-8) [TaxId:10377]
    Gene: gL, BKRF2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Glycoprotein 42
    Species: Epstein-Barr virus (strain GD1) [TaxId:10376]
    Gene: BZLF2
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: E1D1 IgG2a heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T1D (0-212)
  • Chain 'L':
    Compound: E1D1 IgG2a light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T1D (0-216)
    Domains in SCOPe 2.06: d5t1dl1, d5t1dl2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5t1dL (L:)
    divitqtplslpvslgdqasiscrssqsllhsngntylhwylqrpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlminrveaedlgvyfcsqsihvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn