PDB entry 5oab

View 5oab on RCSB PDB site
Description: A novel crystal form of human RNase6 at atomic resolution
Class: hydrolase
Keywords: RNAse k6, hydrolase, pancreatic ribonuclease
Deposited on 2017-06-21, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.11 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease K6
  Species: Homo sapiens [TaxId:9606]
  Gene: RNASE6, RNS6
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q93091 (1-127)
    • initiating methionine (0)
  Domains in SCOPe 2.07: d5oaba_
• Heterogens: PO4, NA, CL, K, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5oabA (A:)
  mwpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdlls
  ivcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklv
  pvhldsil