PDB entry 5nbv

View 5nbv on RCSB PDB site
Description: Crystal structure of native alpha-1-antitrypsin with seven stabilising mutations
Class: hydrolase
Keywords: SERPIN, Hydrolase
Deposited on 2017-03-02, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1-antitrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA1, AAT, PI, PRO0684, PRO2209
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01009 (Start-376)
      • engineered mutation (33)
      • engineered mutation (41)
      • engineered mutation (50)
      • engineered mutation (52)
      • engineered mutation (214)
      • engineered mutation (324)
      • engineered mutation (356)
      • engineered mutation (363)
      • engineered mutation (369)
    Domains in SCOPe 2.07: d5nbva_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nbvA (A:)
    gdhptfnkitpnlaefafslyrqlahqsnstnilfspvsiaaafamlslgakgdthdeil
    eglnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkkl
    yhseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerp
    fevkdteeedfhvdqvttvkvpmmkrlgmfniqhskklsswvllmkylgnataifflpde
    gklqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngad
    lsgvteeaplklskavhkavltidkkgteaagamfleaipmsippevkfnkpfvfliieq
    ntkaplfmgrvvnptqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nbvA (A:)
    nkitpnlaefafslyrqlahqsnstnilfspvsiaaafamlslgakgdthdeileglnfn
    lteipeaqihegfqellrtlnqsqlqlttgnglflseglklvdkfledvkklyhseaftv
    nfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdtee
    edfhvdqvttvkvpmmkrlgmfniqhskklsswvllmkylgnataifflpdegklqhlen
    elthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvteea
    plklskavhkavltidkkgteaagamfleaipmsippevkfnkpfvfliieqntkaplfm
    grvvnptqk