Lineage for d5nbva_ (5nbv A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568351Protein automated matches [190484] (2 species)
    not a true protein
  7. 2568352Species Human (Homo sapiens) [TaxId:9606] [188559] (17 PDB entries)
  8. 3047477Domain d5nbva_: 5nbv A: [347539]
    automated match to d1hp7a_
    complexed with gol; mutant

Details for d5nbva_

PDB Entry: 5nbv (more details), 1.73 Å

PDB Description: crystal structure of native alpha-1-antitrypsin with seven stabilising mutations
PDB Compounds: (A:) alpha-1-antitrypsin

SCOPe Domain Sequences for d5nbva_:

Sequence, based on SEQRES records: (download)

>d5nbva_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkitpnlaefafslyrqlahqsnstnilfspvsiaaafamlslgakgdthdeileglnfn
lteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaf
tvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdt
eeedfhvdqvttvkvpmmkrlgmfniqhskklsswvllmkylgnataifflpdegklqhl
enelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvte
eaplklskavhkavltidkkgteaagamfleaipmsippevkfnkpfvfliieqntkapl
fmgrvvnptqk

Sequence, based on observed residues (ATOM records): (download)

>d5nbva_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkitpnlaefafslyrqlahqsnstnilfspvsiaaafamlslgakgdthdeileglnfn
lteipeaqihegfqellrtlnqsqlqlttgnglflseglklvdkfledvkklyhseaftv
nfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdtee
edfhvdqvttvkvpmmkrlgmfniqhskklsswvllmkylgnataifflpdegklqhlen
elthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvteea
plklskavhkavltidkkgteaagamfleaipmsippevkfnkpfvfliieqntkaplfm
grvvnptqk

SCOPe Domain Coordinates for d5nbva_:

Click to download the PDB-style file with coordinates for d5nbva_.
(The format of our PDB-style files is described here.)

Timeline for d5nbva_:

  • d5nbva_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-06