PDB entry 5lwp

View 5lwp on RCSB PDB site
Description: Discovery of phenoxyindazoles and phenylthioindazoles as RORg inverse agonists
Class: transcription
Keywords: ROR gamma allosteric ligand inverse agonistM, TRANSCRIPTION
Deposited on 2016-09-19, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (2-243)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5lwpa1, d5lwpa2
  • Heterogens: 79U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5lwpA (A:)
hmaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpply
kelf