PDB entry 5lfg

View 5lfg on RCSB PDB site
Description: X-ray structure of a new fully ligated carbomonoxy form of Trematomus newnesi hemoglobin (Hb1TnCO).
Class: oxygen transport
Keywords: OXYGEN TRANSPORT, globin fold
Deposited on 2016-07-01, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha-1
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lfga_
  • Chain 'B':
    Compound: Hemoglobin subunit beta-1/2
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lfgb_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha-1
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lfgc_
  • Chain 'D':
    Compound: Hemoglobin subunit beta-1/2
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lfgd_
  • Heterogens: CMO, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lfgA (A:)
    slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
    kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lfgB (B:)
    vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
    aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflaavvsalgkqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lfgC (C:)
    slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
    kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lfgD (D:)
    vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
    aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflaavvsalgkqyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lfgD (D:)
    vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlygimsnanvaah
    gikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmghaft
    aetqgafqkflaavvsalgkqy