Lineage for d5lfgd_ (5lfg D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2300379Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300384Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (7 PDB entries)
  8. 2300395Domain d5lfgd_: 5lfg D: [337559]
    Other proteins in same PDB: d5lfga_, d5lfgc_
    automated match to d1t1nb_
    complexed with cmo, hem

Details for d5lfgd_

PDB Entry: 5lfg (more details), 1.94 Å

PDB Description: x-ray structure of a new fully ligated carbomonoxy form of trematomus newnesi hemoglobin (hb1tnco).
PDB Compounds: (D:) Hemoglobin subunit beta-1/2

SCOPe Domain Sequences for d5lfgd_:

Sequence, based on SEQRES records: (download)

>d5lfgd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflaavvsalgkqy

Sequence, based on observed residues (ATOM records): (download)

>d5lfgd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlygimsnanvaah
gikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmghaft
aetqgafqkflaavvsalgkqy

SCOPe Domain Coordinates for d5lfgd_:

Click to download the PDB-style file with coordinates for d5lfgd_.
(The format of our PDB-style files is described here.)

Timeline for d5lfgd_: