PDB entry 5jr3

View 5jr3 on RCSB PDB site
Description: Crystal structure of carminomycin-4-O-methyltransferase DnrK in complex with SAH and 4-methylumbelliferone
Class: transferase
Keywords: natural product biosynthesis, Structural Genomics, PSI-Biology, Protein Structure Initiative, Enzyme Discovery for Natural Product Biosynthesis, NatPro, TRANSFERASE
Deposited on 2016-05-05, released 2016-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carminomycin 4-O-methyltransferase DnrK
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: dnrk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jr3a1, d5jr3a2
  • Chain 'B':
    Compound: Carminomycin 4-O-methyltransferase DnrK
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: dnrk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jr3b1, d5jr3b2
  • Chain 'C':
    Compound: Carminomycin 4-O-methyltransferase DnrK
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: dnrk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jr3c1, d5jr3c2
  • Heterogens: SAH, 4MU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jr3A (A:)
    rpqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrli
    rhlvaiglleedapgefvptevgelladdhpaaqrawhdltqavaradisftrlpdairt
    grptyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaaydwtnvrhvldvggg
    kggfaaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvvegdffeplprkadai
    ilsfvllnwpdhdavriltrcaealepggriliherddlhensfneqfteldlrmlvflg
    galrtrekwdglaasaglvveevrqlpsptipydlsllvlapaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jr3A (A:)
    pqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrlir
    hlvaiglleedapgefvptevgelladdhpaaqrawhdltqavaradisftrlpdairtg
    rptyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaaydwtnvrhvldvgggk
    ggfaaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvvegdffeplprkadaii
    lsfvllnwpdhdavriltrcaealepggriliherddlhensfneqfteldlrmlvflgg
    alrtrekwdglaasaglvveevrqlpsptipydlsllvlapaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jr3B (B:)
    rpqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrli
    rhlvaiglleedapgefvptevgelladdhpaaqrawhdltqavaradisftrlpdairt
    grptyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaaydwtnvrhvldvggg
    kggfaaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvvegdffeplprkadai
    ilsfvllnwpdhdavriltrcaealepggriliherddlhensfneqfteldlrmlvflg
    galrtrekwdglaasaglvveevrqlpsptipydlsllvlapaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jr3B (B:)
    qidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrlirhl
    vaiglleedapgefvptevgelladdhpaaqrawhdltqavaradisftrlpdairtgrp
    tyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaaydwtnvrhvldvgggkgg
    faaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvvegdffeplprkadaiils
    fvllnwpdhdavriltrcaealepggriliherddlhensfneqfteldlrmlvflggal
    rtrekwdglaasaglvveevrqlpsptipydlsllvlapa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jr3C (C:)
    rpqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrli
    rhlvaiglleedapgefvptevgelladdhpaaqrawhdltqavaradisftrlpdairt
    grptyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaaydwtnvrhvldvggg
    kggfaaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvvegdffeplprkadai
    ilsfvllnwpdhdavriltrcaealepggriliherddlhensfneqfteldlrmlvflg
    galrtrekwdglaasaglvveevrqlpsptipydlsllvlapaa