PDB entry 5jpx

View 5jpx on RCSB PDB site
Description: Solution structure of the TRIM21 B-box2 (B2)
Class: metal binding protein
Keywords: B-box, Metal binding protein, RING-like fold, E3 ligase, TRIM protein, Zinc-binding motif, Ubiquitination
Deposited on 2016-05-04, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e3 ubiquitin-protein ligase trim21
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM21, RNF81, RO52, SSA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jpxa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jpxA (A:)
gtqgercavhgerlhlfcekdgkalcwvcaqsrkhrdhamvplee