PDB entry 5jfb

View 5jfb on RCSB PDB site
Description: Crystal structure of the scavenger receptor cysteine-rich domain 5 (SRCR5) from porcine CD163
Class: endocytosis
Keywords: cd163, srcr, prrsv, endocytosis
Deposited on 2016-04-19, released 2017-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Scavenger receptor cysteine-rich type 1 protein M130
    Species: Sus scrofa [TaxId:9823]
    Gene: CD163, M130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2VL90 (2-102)
      • expression tag (0-1)
      • expression tag (103)
    Domains in SCOPe 2.06: d5jfba1, d5jfba2, d5jfba3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5jfbA (A:)
rsprlvggdipcsgrvevqhgdtwgtvcdsdfsleaasvlcrelqcgtvvsllggahfge
gsgqiwaeefqcegheshlslcpvaprpdgtcshsrdvgvvcstrtghhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5jfbA (A:)
rsprlvggdipcsgrvevqhgdtwgtvcdsdfsleaasvlcrelqcgtvvsllggahfge
gsgqiwaeefqcegheshlslcpvaprpdgtcshsrdvgvvcst