PDB entry 5j9z

View 5j9z on RCSB PDB site
Description: EGFR-T790M in complex with pyrazolopyrimidine inhibitor 1a
Class: transferase
Keywords: tyrosine kinase, covalent inhibitor, drug resistance, transferase
Deposited on 2016-04-11, released 2016-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (0-324)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d5j9za_
  • Heterogens: 6HJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j9zA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
    vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
    ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
    nfyralmdeedmddvvdadeylipq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j9zA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakvpikwmalesilhri
    ythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkc
    wmidadsrpkfreliiefskmardpqrylviqgdermmddvvdadeylipq