Lineage for d5j9za_ (5j9z A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543502Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2543503Species Human (Homo sapiens) [TaxId:9606] [82796] (101 PDB entries)
    Uniprot P00533 702-1018
  8. 2543567Domain d5j9za_: 5j9z A: [321460]
    automated match to d3ikaa_
    complexed with 6hj

Details for d5j9za_

PDB Entry: 5j9z (more details), 2.5 Å

PDB Description: egfr-t790m in complex with pyrazolopyrimidine inhibitor 1a
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d5j9za_:

Sequence, based on SEQRES records: (download)

>d5j9za_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
nkeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyll
nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
nfyralmdeedmddvvdadeylipq

Sequence, based on observed residues (ATOM records): (download)

>d5j9za_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
nkeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyll
nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakvpikwmalesilhri
ythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkc
wmidadsrpkfreliiefskmardpqrylviqgdermmddvvdadeylipq

SCOPe Domain Coordinates for d5j9za_:

Click to download the PDB-style file with coordinates for d5j9za_.
(The format of our PDB-style files is described here.)

Timeline for d5j9za_: