PDB entry 5j9t

View 5j9t on RCSB PDB site
Description: Crystal structure of the NuA4 core complex
Class: transferase
Keywords: NuA4, nucleosome, histone, acetylation, TRANSFERASE
Deposited on 2016-04-11, released 2016-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase ESA1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ESA1, YOR244W, O5257
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08649
      • engineered mutation (197)
    Domains in SCOPe 2.07: d5j9ta_
  • Chain 'B':
    Compound: Chromatin modification-related protein EAF6
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: EAF6, YJR082C, J1854
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Enhancer of polycomb-like protein 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: EPL1, YFL024C
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Chromatin modification-related protein YNG2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YNG2, EAF4, NBN1, YHR090C
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Histone acetyltransferase ESA1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ESA1, YOR244W, O5257
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08649
      • engineered mutation (197)
    Domains in SCOPe 2.07: d5j9te_
  • Chain 'F':
    Compound: Chromatin modification-related protein EAF6
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: EAF6, YJR082C, J1854
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Enhancer of polycomb-like protein 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: EPL1, YFL024C
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Chromatin modification-related protein YNG2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YNG2, EAF4, NBN1, YHR090C
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Histone acetyltransferase ESA1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ESA1, YOR244W, O5257
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08649
      • engineered mutation (197)
    Domains in SCOPe 2.07: d5j9ti_
  • Chain 'J':
    Compound: Chromatin modification-related protein EAF6
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: EAF6, YJR082C, J1854
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Enhancer of polycomb-like protein 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: EPL1, YFL024C
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Chromatin modification-related protein YNG2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YNG2, EAF4, NBN1, YHR090C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j9tA (A:)
    hedeikklrtsgsmtqnphevarvrnlnriimgkyeiepwyfspypieltdedfiyiddf
    tlqyfgskkqyeryrkkctlrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfld
    hktlyydvdpflfycmtrrdelghhlvgyfskekesadgynvaciltlpqyqrmgygkll
    iefsyelskkenkvgspqkplsdlgllsyraywsdtlitllvehqkeitideissmtsmt
    ttdilhtaktlnilryykgqhiiflnedildrynrlkakkrrtidpnrliwkppvftasq
    lrfaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j9tA (A:)
    evarvrnlnriimgkyeiepwyfspypieltdedfiyiddftlqyfgskkqyeryrkkct
    lrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfldhktlyydvdpflfycmtrr
    delghhlvgyfskekesadgynvaciltlpqyqrmgygklliefsyelskkenkvgspqk
    plsdlgllsyraywsdtlitllvehqkeitideissmtsmtttdilhtaktlnilryykg
    qhiiflnedildrynrlkakkrrtidpnrliwkppvft
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5j9tE (E:)
    hedeikklrtsgsmtqnphevarvrnlnriimgkyeiepwyfspypieltdedfiyiddf
    tlqyfgskkqyeryrkkctlrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfld
    hktlyydvdpflfycmtrrdelghhlvgyfskekesadgynvaciltlpqyqrmgygkll
    iefsyelskkenkvgspqkplsdlgllsyraywsdtlitllvehqkeitideissmtsmt
    ttdilhtaktlnilryykgqhiiflnedildrynrlkakkrrtidpnrliwkppvftasq
    lrfaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j9tE (E:)
    evarvrnlnriimgkyeiepwyfspypieltdedfiyiddftlqyfgskkqyeryrkkct
    lrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfldhktlyydvdpflfycmtrr
    delghhlvgyfskekesadgynvaciltlpqyqrmgygklliefsyelskkenkvgspqk
    plsdlgllsyraywsdtlitllvehqkeitideissmtsmtttdilhtaktlnilryykg
    qhiiflnedildrynrlkakkrrtidpnrliwkppvft
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5j9tI (I:)
    hedeikklrtsgsmtqnphevarvrnlnriimgkyeiepwyfspypieltdedfiyiddf
    tlqyfgskkqyeryrkkctlrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfld
    hktlyydvdpflfycmtrrdelghhlvgyfskekesadgynvaciltlpqyqrmgygkll
    iefsyelskkenkvgspqkplsdlgllsyraywsdtlitllvehqkeitideissmtsmt
    ttdilhtaktlnilryykgqhiiflnedildrynrlkakkrrtidpnrliwkppvftasq
    lrfaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j9tI (I:)
    varvrnlnriimgkyeiepwyfspypieltdedfiyiddftlqyfgskkqyeryrkkctl
    rhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfldhktlyydvdpflfycmtrrd
    elghhlvgyfskekesadgynvaciltlpqyqrmgygklliefsyelskkenkvgspqkp
    lsdlgllsyraywsdtlitllvehqkeitideissmtsmtttdilhtaktlnilryykgq
    hiiflnedildrynrlkakkrrtidpnrliwkppvft
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.