Lineage for d5j9te_ (5j9t E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968734Protein automated matches [190241] (13 species)
    not a true protein
  7. 2968749Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [324445] (3 PDB entries)
  8. 2968751Domain d5j9te_: 5j9t E: [324545]
    automated match to d3to9a_

Details for d5j9te_

PDB Entry: 5j9t (more details), 2.7 Å

PDB Description: crystal structure of the nua4 core complex
PDB Compounds: (E:) Histone acetyltransferase ESA1

SCOPe Domain Sequences for d5j9te_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j9te_ d.108.1.1 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
evarvrnlnriimgkyeiepwyfspypieltdedfiyiddftlqyfgskkqyeryrkkct
lrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfldhktlyydvdpflfycmtrr
delghhlvgyfskekesadgynvaciltlpqyqrmgygklliefsyelskkenkvgspqk
plsdlgllsyraywsdtlitllvehqkeitideissmtsmtttdilhtaktlnilryykg
qhiiflnedildrynrlkakkrrtidpnrliwkppvft

SCOPe Domain Coordinates for d5j9te_:

Click to download the PDB-style file with coordinates for d5j9te_.
(The format of our PDB-style files is described here.)

Timeline for d5j9te_: