PDB entry 5j76
View 5j76 on RCSB PDB site
Description: Structure of Lectin from Colocasia esculenta(L.) Schott
Class: sugar binding protein
Keywords: Sugar Binding, Lectin, Colocasia agglutinin, SUGAR BINDING PROTEIN
Deposited on
2016-04-06, released
2016-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated
2016-06-29, with a file datestamp of
2016-06-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 12kD storage protein
Species: Colocasia esculenta [TaxId:4460]
Database cross-references and differences (RAF-indexed):
- Uniprot Q39487 (0-108)
- conflict (57)
- conflict (74)
- conflict (86)
- conflict (96)
- conflict (105)
Domains in SCOPe 2.07: d5j76a_ - Chain 'B':
Compound: 12kD storage protein
Species: Colocasia esculenta [TaxId:4460]
Database cross-references and differences (RAF-indexed):
- Uniprot Q39487 (0-110)
- conflict (68)
- conflict (80)
- conflict (96)
Domains in SCOPe 2.07: d5j76b_ - Heterogens: GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5j76A (A:)
lgtnyllsgqtleteghlkngdfdlvmqddcnlvlyngnwqsntankgrdckltltdyge
lvinngdgstvwrskaqsvkgdyaavdhpegrlvvfgpsvfkidpwvpg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5j76B (B:)
nipftnnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
nhkgeliikdddfktiwsssssskqgdyvlilrddgfaviygpaiwetspq