PDB entry 5j57

View 5j57 on RCSB PDB site
Description: V5E1-RTA complex
Class: hydrolase/immune system
Keywords: Ricin, RTA, single chain antibodies (VHH), HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2016-04-01, released 2016-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5j57a_
  • Chain 'B':
    Compound: VHH single chain antibody V5E1
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5J57 (0-126)
    Domains in SCOPe 2.08: d5j57b_
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j57A (A:)
    mifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfil
    velsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfaf
    ggnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaa
    rfqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngsk
    fsvydvsilipiialmvyrcapppssqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j57A (A:)
    kqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvels
    nhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggny
    drleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqy
    iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvy
    dvsilipiialmvyrcapppssqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j57B (B:)
    vqlaetggglvepggslrlscaapefrlqyytagwfrqapgkerewvacisagggvtyyt
    gsvqgrftisrdnakrtvylqmdslkpedtavyscaadleysqimpscrgsygvrgqgtq
    vtvssah
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j57B (B:)
    vqlaetggglvepggslrlscaapefrlqyytagwfrqaerewvacisagggvtyytgsv
    qgrftisrdnakrtvylqmdslkpedtavyscaadleysqimpscrgsygvrgqgtqvtv
    ssah