PDB entry 5hyw

View 5hyw on RCSB PDB site
Description: The crystal structure of the D3-ASK1 complex
Class: signaling protein/protein binding
Keywords: F-box protein, SIGNALING PROTEIN-PROTEIN BINDING complex
Deposited on 2016-02-02, released 2016-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F-box/LRR-repeat MAX2 homolog
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: D3, Os06g0154200, LOC_Os06g06050, OSJNBa0085L11.6-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: SKP1-like protein 1A
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SKP1A, ASK1, SKP1, UIP1, At1g75950, T4O12.17
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: F-box/LRR-repeat MAX2 homolog
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: D3, Os06g0154200, LOC_Os06g06050, OSJNBa0085L11.6-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: SKP1-like protein 1A
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SKP1A, ASK1, SKP1, UIP1, At1g75950, T4O12.17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hywd_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >5hywD (D:)
mdykddddkmsakkivlkssdgesfeveeavalesqtiahmveddcvdngvplpnvtski
lakvieyckrhveaaaskaeavegaatsdddlkawdadfmkidqatlfelilaanylnik
nlldltcqtvadmikgktpeeirttfnikndftpeeeeevrrenqwafe

    Sequence, based on observed residues (ATOM records): (download) 
    >5hywD (D:)
mkidqatlfelilaanylniknlldltcqtvadmikgktpeeirttfnikndftpeeeee
vrrenqwafe