PDB entry 5h7e

View 5h7e on RCSB PDB site
Description: Crystal Structure of native drCPDase
Class: hydrolase
Keywords: RNA repair, CPDase, 2, 3 -cyclic phosphodiesterase, HYDROLASE
Deposited on 2016-11-18, released 2017-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA 2',3'-cyclic phosphodiesterase
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_2339
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5h7ea_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5h7eA (A:)
hqpstyrlfyalrvpaditaplaeaqaklrgnwravrpdqmhvtlsylpavppervedlk
rlgtrltqdlpplhvnlrgtgyfpnegsprvwfvkteaegltelaenlragirelgigtd
dlafkahitlarkkgpaprlpplifdqswtapgltlyrsilrktgpiyevqstfrfrgsa
sq