Lineage for d5h7ea_ (5h7e A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956563Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2956564Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2956626Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 2956627Protein automated matches [190796] (6 species)
    not a true protein
  7. 2956630Species Deinococcus radiodurans [TaxId:1299] [339496] (2 PDB entries)
  8. 2956632Domain d5h7ea_: 5h7e A: [339497]
    automated match to d1iuha_
    complexed with gol, so4

Details for d5h7ea_

PDB Entry: 5h7e (more details), 1.6 Å

PDB Description: crystal structure of native drcpdase
PDB Compounds: (A:) RNA 2',3'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5h7ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h7ea_ d.61.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
hqpstyrlfyalrvpaditaplaeaqaklrgnwravrpdqmhvtlsylpavppervedlk
rlgtrltqdlpplhvnlrgtgyfpnegsprvwfvkteaegltelaenlragirelgigtd
dlafkahitlarkkgpaprlpplifdqswtapgltlyrsilrktgpiyevqstfrfrgsa
sq

SCOPe Domain Coordinates for d5h7ea_:

Click to download the PDB-style file with coordinates for d5h7ea_.
(The format of our PDB-style files is described here.)

Timeline for d5h7ea_: