Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.61: LigT-like [55143] (1 superfamily) duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III |
Superfamily d.61.1: LigT-like [55144] (5 families) |
Family d.61.1.0: automated matches [191492] (1 protein) not a true family |
Protein automated matches [190796] (6 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [339496] (2 PDB entries) |
Domain d5h7ea_: 5h7e A: [339497] automated match to d1iuha_ complexed with gol, so4 |
PDB Entry: 5h7e (more details), 1.6 Å
SCOPe Domain Sequences for d5h7ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h7ea_ d.61.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]} hqpstyrlfyalrvpaditaplaeaqaklrgnwravrpdqmhvtlsylpavppervedlk rlgtrltqdlpplhvnlrgtgyfpnegsprvwfvkteaegltelaenlragirelgigtd dlafkahitlarkkgpaprlpplifdqswtapgltlyrsilrktgpiyevqstfrfrgsa sq
Timeline for d5h7ea_: