PDB entry 5h0y

View 5h0y on RCSB PDB site
Description: Crystal structure of H88Y mutated human transthyretin
Class: transport protein
Keywords: transthhyretin, amyloidosis, transporter, TRANSPORT PROTEIN
Deposited on 2016-10-07, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (9-End)
      • expression tag (7-8)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d5h0ya1, d5h0ya2
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5h0yA (A:)
ahhhhhhmsplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltte
eefvegiykveidtksywkalgispfyehaevvftandsgprrytiaallspysysttav
vtnpke

    Sequence, based on observed residues (ATOM records): (download) 
    >5h0yA (A:)
msplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
ykveidtksywkalgispfyehaevvftandsgprrytiaallspysysttavvtn