PDB entry 5fwg

View 5fwg on RCSB PDB site
Description: tetra-(5-fluorotryptophanyl)-glutathione transferase
Class: transferase
Keywords: glutathione transferase, unnatural amino acid, 5-fluorotryptophan, three-dimensional structure
Deposited on 1997-11-08, released 1999-01-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetra-(5-fluorotryptophanyl)-glutathione transferase mu class
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA INSERT OF 3-3 (M1-1) ENZY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04905 (0-216)
      • conflict (6)
      • conflict (44)
      • conflict (145)
      • conflict (213)
    Domains in SCOPe 2.02: d5fwga1, d5fwga2
  • Chain 'B':
    Compound: tetra-(5-fluorotryptophanyl)-glutathione transferase mu class
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA INSERT OF 3-3 (M1-1) ENZY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04905 (0-216)
      • conflict (6)
      • conflict (44)
      • conflict (145)
      • conflict (213)
    Domains in SCOPe 2.02: d5fwgb1, d5fwgb2
  • Heterogens: GPR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fwgA (A:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fwgB (B:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk