PDB entry 5egj

View 5egj on RCSB PDB site
Description: The structural and biochemical characterization of acyl-coa hydrolase from Staphylococcus aureus in complex with COENZYME A
Class: hydrolase
Keywords: Acyl CoA thioesterase, Staphylococcus aureus, Coenzyme A, Hotdog thioesterase, HYDROLASE
Deposited on 2015-10-27, released 2015-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl CoA Hydrolase
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: SAV1878
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5egja_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5egjA (A:)
snamtnqdrpmksmseskcyknrqvfpqdtahhhtmfggtlmanideiaaitamkhagaq
vvtastdsvdflkpiktgdilqyvamvsyagtssmevvvqiriddvfnnkhdlaalsylt
fvalddegkpkhvpgvypeddvekwfydtapqrverrkarrieskqtieylaqaqhird

    Sequence, based on observed residues (ATOM records): (download) 
    >5egjA (A:)
drpmksmseskcyknrqvfpqdtahhhtmfggtlmanideiaaitamkhagaqvvtastd
svdflkpiktgdilqyvamvsyagtssmevvvqiriddvfnnkhdlaalsyltfvaldde
gkpkhvpgvypeddvekwfydtapqrverrkarrieskqtieylaqa