Lineage for d5egja_ (5egj A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902478Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1902479Protein automated matches [190143] (32 species)
    not a true protein
  7. 1902659Species Staphylococcus aureus [TaxId:158878] [260692] (4 PDB entries)
  8. 1902675Domain d5egja_: 5egj A: [279308]
    automated match to d4ncpc_
    complexed with coa

Details for d5egja_

PDB Entry: 5egj (more details), 2.4 Å

PDB Description: the structural and biochemical characterization of acyl-coa hydrolase mutant asn28ala from staphylococcus aureus in complex with coenzyme a
PDB Compounds: (A:) Acyl CoA Hydrolase

SCOPe Domain Sequences for d5egja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5egja_ d.38.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
drpmksmseskcyknrqvfpqdtahhhtmfggtlmanideiaaitamkhagaqvvtastd
svdflkpiktgdilqyvamvsyagtssmevvvqiriddvfnnkhdlaalsyltfvaldde
gkpkhvpgvypeddvekwfydtapqrverrkarrieskqtieylaqa

SCOPe Domain Coordinates for d5egja_:

Click to download the PDB-style file with coordinates for d5egja_.
(The format of our PDB-style files is described here.)

Timeline for d5egja_: