PDB entry 5d2b

View 5d2b on RCSB PDB site
Description: Crystal structure of a mutated catalytic domain of Human MMP12 in complex with an hydroxamate analogue of RXP470
Class: hydrolase
Keywords: Metzincin, Matrix Metallo Elastase, MMP12, human, RXP470, Macrophage, Hydrolase, Hydroxamate based inhibitor
Deposited on 2015-08-05, released 2016-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • initiating methionine (0)
      • engineered mutation (66)
    Domains in SCOPe 2.06: d5d2ba1, d5d2ba2
  • Heterogens: ZN, CA, 56O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5d2bA (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslyg