PDB entry 5ccr

View 5ccr on RCSB PDB site
Description: Human Cyclophilin D Complexed with Inhibitor
Class: isomerase
Keywords: Cyclophilin, isomerase, complex, inhibitor
Deposited on 2015-07-02, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase F, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIF, CYP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30405 (1-164)
      • engineered mutation (132)
    Domains in SCOPe 2.07: d5ccra_
  • Heterogens: K, FMT, PG4, PGE, 4ZT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5ccrA (A:)
mgnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsf
mcqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktd
wldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

    Sequence, based on observed residues (ATOM records): (download) 
    >5ccrA (A:)
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls