PDB entry 5c58

View 5c58 on RCSB PDB site
Description: A double mutant of serratia marcescens hemophore receptor HasR in complex with its hemophore HasA and heme
Class: transport protein
Keywords: outer membrane receptor, transporter complex, heme transfer, transport protein
Deposited on 2015-06-19, released 2016-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-08, with a file datestamp of 2020-04-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HasR protein
    Species: Serratia marcescens [TaxId:615]
    Gene: hasR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79AD2 (Start-864)
      • engineered mutation (644)
  • Chain 'B':
    Compound: hemophore hasa
    Species: Serratia marcescens [TaxId:615]
    Gene: hasA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5c58b_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5c58B (B:)
mrgshhhhhhgirmrarypafsvnydssfggysihdylgqwastfgdvnhtngnvtdans
ggfyggslsgsqyaisstanqvtafvaggnltytlfnepahtlygqldslsfgdglsggd
tspysiqvpdvsfgglnlsslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsv
nstfdqvaaatavgvqhadspellaa

    Sequence, based on observed residues (ATOM records): (download) 
    >5c58B (B:)
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata