Lineage for d5c58b_ (5c58 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943155Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 2943156Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 2943174Family d.35.1.0: automated matches [196913] (1 protein)
    not a true family
  6. 2943175Protein automated matches [196914] (3 species)
    not a true protein
  7. 2943176Species Serratia marcescens [TaxId:615] [255779] (2 PDB entries)
  8. 2943177Domain d5c58b_: 5c58 B: [318915]
    automated match to d4jera_
    complexed with hem; mutant

Details for d5c58b_

PDB Entry: 5c58 (more details), 2.8 Å

PDB Description: a double mutant of serratia marcescens hemophore receptor hasr in complex with its hemophore hasa and heme
PDB Compounds: (B:) hemophore hasa

SCOPe Domain Sequences for d5c58b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c58b_ d.35.1.0 (B:) automated matches {Serratia marcescens [TaxId: 615]}
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata

SCOPe Domain Coordinates for d5c58b_:

Click to download the PDB-style file with coordinates for d5c58b_.
(The format of our PDB-style files is described here.)

Timeline for d5c58b_: