![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily) beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432 |
![]() | Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) ![]() |
![]() | Family d.35.1.0: automated matches [196913] (1 protein) not a true family |
![]() | Protein automated matches [196914] (3 species) not a true protein |
![]() | Species Serratia marcescens [TaxId:615] [255779] (2 PDB entries) |
![]() | Domain d5c58b_: 5c58 B: [318915] automated match to d4jera_ complexed with hem; mutant |
PDB Entry: 5c58 (more details), 2.8 Å
SCOPe Domain Sequences for d5c58b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c58b_ d.35.1.0 (B:) automated matches {Serratia marcescens [TaxId: 615]} afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata
Timeline for d5c58b_: