PDB entry 5brc

View 5brc on RCSB PDB site
Description: oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2
Deposited on 2015-05-30, released 2016-07-27
Made obsolete by 5xbp on 2017-04-19

The last revision was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3NT oxygenase alpha subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAc
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 3NT oxygenase beta subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAd
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 3NT oxygenase alpha subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAc
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 3NT oxygenase beta subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAd
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 3NT oxygenase alpha subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAc
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 3NT oxygenase beta subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAd
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, FES, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5brcA (A:)
    msyqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmgld
    evivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfeke
    lygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglel
    vgppgkvvvkanwktfaenfvgdiyhvgwthasilrvgqsvftplagnamlppegsglqm
    tskygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifp
    nnsfltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesdd
    ndnmetlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqa
    hisssnwaefenasrnwhteltkttd
    

    Sequence, based on observed residues (ATOM records):
    >5brcA (A:)
    syqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmglde
    vivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfekel
    ygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglelv
    gppgkvvvkanwktfaenfvgdiyhvgwthailrvgqsvftplagnamlppegsglmtsk
    ygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifpnns
    fltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesddndn
    metlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqahis
    ssnwaefenasrnwhteltktt
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5brcC (C:)
    mmintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvap
    eikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfv
    tnvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdy
    perilphnllvfl
    

    Sequence, based on observed residues (ATOM records):
    >5brcC (C:)
    mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape
    ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt
    nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp
    erilphnllvfl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5brcD (D:)
    msyqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmgld
    evivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfeke
    lygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglel
    vgppgkvvvkanwktfaenfvgdiyhvgwthasilrvgqsvftplagnamlppegsglqm
    tskygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifp
    nnsfltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesdd
    ndnmetlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqa
    hisssnwaefenasrnwhteltkttd
    

    Sequence, based on observed residues (ATOM records):
    >5brcD (D:)
    syqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmglde
    vivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfekel
    ygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglelv
    gppgkvvvkanwktfaenfvgdiyhvgwthasilrvgqsvftplagnamlppegsglqmt
    skygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifpn
    nsfltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesddn
    dnmetlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqah
    isssnwaefenasrnwhteltktt
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5brcF (F:)
    mmintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvap
    eikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfv
    tnvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdy
    perilphnllvfl
    

    Sequence, based on observed residues (ATOM records):
    >5brcF (F:)
    mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape
    ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt
    nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp
    erilphnllvfl
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5brcG (G:)
    msyqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmgld
    evivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfeke
    lygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglel
    vgppgkvvvkanwktfaenfvgdiyhvgwthasilrvgqsvftplagnamlppegsglqm
    tskygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifp
    nnsfltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesdd
    ndnmetlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqa
    hisssnwaefenasrnwhteltkttd
    

    Sequence, based on observed residues (ATOM records):
    >5brcG (G:)
    syqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmglde
    vivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfekel
    ygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglelv
    gppgkvvvkanwktfaenfvgdiyhvgwthasilrvgqsvftplagnamlppegsglqmt
    skygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifpn
    nsfltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesddn
    dnmetlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqah
    isssnwaefenasrnwhteltktt
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5brcI (I:)
    mmintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvap
    eikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfv
    tnvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdy
    perilphnllvfl
    

    Sequence, based on observed residues (ATOM records):
    >5brcI (I:)
    mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape
    ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt
    nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp
    erilphnllvfl