PDB entry 5xbp

View 5xbp on RCSB PDB site
Description: Oxygenase component of 3-nitrotoluene dioxygenase from Diaphorobacter sp. strain DS2
Class: metal binding protein
Keywords: Rieske non-heme oxygenase, iron-sulfur clusters, oxidoreductase, nitroaromatic compounds degrader, METAL BINDING PROTEIN
Deposited on 2017-03-21, released 2017-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3NT oxygenase alpha subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xbpa1, d5xbpa2
  • Chain 'C':
    Compound: 3NT oxygenase beta subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xbpc_
  • Chain 'D':
    Compound: 3NT oxygenase alpha subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xbpd1, d5xbpd2
  • Chain 'F':
    Compound: 3NT oxygenase beta subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xbpf_
  • Chain 'G':
    Compound: 3NT oxygenase alpha subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xbpg1, d5xbpg2
  • Chain 'I':
    Compound: 3NT oxygenase beta subunit
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xbpi_
  • Heterogens: FE, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xbpA (A:)
    msyqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmgld
    evivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfeke
    lygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglel
    vgppgkvvvkanwktfaenfvgdiyhvgwthasilrvgqsvftplagnamlppegsglqm
    tskygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifp
    nnsfltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesdd
    ndnmetlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqa
    hisssnwaefenasrnwhteltkttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xbpA (A:)
    syqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmglde
    vivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfekel
    ygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglelv
    gppgkvvvkanwktfaenfvgdiyhvgwthasilrvgqsvftplagnamlppegsglqmt
    skygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifpn
    nsfltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesddn
    dnmetlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqah
    isssnwaefenasrnwhteltktt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xbpC (C:)
    mmintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvap
    eikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfv
    tnvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdy
    perilphnllvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xbpC (C:)
    mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape
    ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt
    nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp
    erilphnllvfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xbpD (D:)
    msyqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmgld
    evivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfeke
    lygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglel
    vgppgkvvvkanwktfaenfvgdiyhvgwthasilrvgqsvftplagnamlppegsglqm
    tskygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifp
    nnsfltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesdd
    ndnmetlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqa
    hisssnwaefenasrnwhteltkttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xbpD (D:)
    syqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmglde
    vivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfekel
    ygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglelv
    gppgkvvvkanwktfaenfvgdiyhvgwthasilrvgqsvftplagnamlppegsglqmt
    skygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifpn
    nsfltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesddn
    dnmetlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqah
    isssnwaefenasrnwhteltktt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xbpF (F:)
    mmintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvap
    eikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfv
    tnvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdy
    perilphnllvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xbpF (F:)
    mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape
    ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt
    nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp
    erilphnllvfl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5xbpG (G:)
    msyqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmgld
    evivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfeke
    lygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglel
    vgppgkvvvkanwktfaenfvgdiyhvgwthasilrvgqsvftplagnamlppegsglqm
    tskygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifp
    nnsfltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesdd
    ndnmetlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqa
    hisssnwaefenasrnwhteltkttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xbpG (G:)
    syqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmglde
    vivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfekel
    ygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawymeptfkhsgglelv
    gppgkvvvkanwktfaenfvgdiyhvgwthasilrvgqsvftplagnamlppegsglqmt
    skygsgmslmwdyyagnhsadlvpdlmafggakqeklakeigdvrariyrshlngtifpn
    nsfltgsaafkvwnpidenttevwtyafvekdmpedlkrrladavqrtvgpggywesddn
    dnmetlsqnakkyqssnsdliaslgfgkdvygdecypgvvgpsgasetsyrgfyrayqah
    isssnwaefenasrnwhteltktt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5xbpI (I:)
    mmintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvap
    eikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfv
    tnvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdy
    perilphnllvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xbpI (I:)
    mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape
    ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt
    nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp
    erilphnllvfl