PDB entry 5b6c

View 5b6c on RCSB PDB site
Description: Structural Details of Ufd1 binding to p97
Class: hydrolase/protein binding
Keywords: Ufd1, SHP box, p97, HYDROLASE-PROTEIN BINDING complex
Deposited on 2016-05-26, released 2017-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-04, with a file datestamp of 2016-12-30.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transitional endoplasmic reticulum ATPase
  Species: Homo sapiens [TaxId:9606]
  Gene: VCP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55072 (2-172)
    • expression tag (0-1)
    • expression tag (173)
  Domains in SCOPe 2.07: d5b6ca1, d5b6ca2, d5b6ca3, d5b6ca4
• Chain 'B':
  Compound: Peptide from Ubiquitin fusion degradation protein 1 homolog
  Species: Homo sapiens [TaxId:9606]
  Gene: UFD1L
  Database cross-references and differences (RAF-indexed):
  • Uniprot C9JNP9 (0-10)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5b6cA (A:)
  gsnrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcs
  dekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpy
  fleayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikra
  

  
  
• Chain 'B':
  No sequence available.