PDB entry 5ar6

View 5ar6 on RCSB PDB site
Description: crystal structure of porcine RNase 4
Class: hydrolase
Keywords: hydrolase, ribonuclease 4, RNA degradation
Deposited on 2015-09-24, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease 4
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15468 (3-121)
    • expression tag (0-2)
  Domains in SCOPe 2.07: d5ar6a1, d5ar6a2
• Heterogens: EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ar6A (A:)
  aamqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsic
  stsniqckngqmnchegvvkvtdcretgssrapncryramastrrvviacegnpevpvhf
  dk