PDB entry 5a5d

View 5a5d on RCSB PDB site
Description: A complex of the synthetic siderophore analogue Fe(III)-5-LICAM with the CeuE periplasmic protein from Campylobacter jejuni
Class: transport protein
Keywords: transport protein, synthetic siderophore, ligand complex, periplasmic binding protein, tetradentate siderophores
Deposited on 2015-06-17, released 2016-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: enterochelin uptake periplasmic binding protein
  Species: Campylobacter jejuni [TaxId:197]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q0P8Q4 (2-288)
    • expression tag (0-1)
  Domains in SCOPe 2.06: d5a5da1, d5a5da2
• Heterogens: FE, 5LC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5a5dA (A:)
  amlpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknl
  pkylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnan
  flssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafg
  pqsrfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqg
  ildnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk