PDB entry 4znf

View 4znf on RCSB PDB site
Description: high-resolution three-dimensional structure of a single zinc finger from a human enhancer binding protein in solution
Class: zinc finger DNA binding domain
Keywords: zinc finger DNA binding domain
Deposited on 1990-07-09, released 1992-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc finger
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15822 (0-29)
      • conflict (5)
    Domains in SCOPe 2.07: d4znfa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4znfA (A:)
    rpyhcsycnfsfktkgnltkhmkskahskk