PDB entry 4zls

View 4zls on RCSB PDB site
Description: HIV-1 wild Type protease with GRL-096-13A (a Boc-derivative P2-Ligand, 3,-5-dimethylbiphenyl P1-Ligand)
Class: HYDROLASE/HYDROLASE Inhibitor
Keywords: multidrug-resistant strains, HYDROLASE Inhibitor complex, HYDROLASE-HYDROLASE Inhibitor complex
Deposited on 2015-05-01, released 2015-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus type 1 BH10 [TaxId:11678]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.06: d4zlsa_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus type 1 BH10 [TaxId:11678]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.06: d4zlsb_
• Heterogens: NA, CL, G61, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4zlsA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4zlsB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf