PDB entry 4yyx

View 4yyx on RCSB PDB site
Description: Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin2 C-terminal tail
Class: cell adhesion
Keywords: Tight junction, MAGUK, PDZ1, SCAFFOLDING, CELL ADHESION, Claudin
Deposited on 2015-03-24, released 2015-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tight junction protein ZO-1 fused with Claudin-2 C-terminal
    Species: Homo sapiens [TaxId:9606]
    Gene: CLDN2, PSEC0059, SP82, UNQ705/PRO1356
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07157 (4-96)
      • expression tag (3)
      • linker (97-99)
    • Uniprot P57739 (100-106)
    Domains in SCOPe 2.08: d4yyxa1, d4yyxa2
  • Chain 'B':
    Compound: Tight junction protein ZO-1 fused with Claudin-2 C-terminal
    Species: Homo sapiens [TaxId:9606]
    Gene: CLDN2, PSEC0059, SP82, UNQ705/PRO1356
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07157 (4-96)
      • expression tag (2-3)
      • linker (97-99)
    • Uniprot P57739 (100-106)
    Domains in SCOPe 2.08: d4yyxb1, d4yyxb2
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4yyxA (A:)
gshmiweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqend
rvamvngvsmdnvehafavqqlrksgknakitirrkkgggysltgyv

    Sequence, based on observed residues (ATOM records): (download) 
    >4yyxA (A:)
miweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqendrva
mvngvsmdnvehafavqqlrksgknakitirrkkgggysltgyv

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4yyxB (B:)
gshmiweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqend
rvamvngvsmdnvehafavqqlrksgknakitirrkkgggysltgyv

    Sequence, based on observed residues (ATOM records): (download) 
    >4yyxB (B:)
hmiweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqendrv
amvngvsmdnvehafavqqlrksgknakitirrkkgggysltgyv