Lineage for d4yyxa1 (4yyx A:18-120)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2379973Protein automated matches [190055] (6 species)
    not a true protein
  7. 2379982Species Human (Homo sapiens) [TaxId:9606] [187785] (40 PDB entries)
  8. 2380013Domain d4yyxa1: 4yyx A:18-120 [271160]
    Other proteins in same PDB: d4yyxa2, d4yyxb2
    automated match to d2h2ba_
    complexed with fmt

Details for d4yyxa1

PDB Entry: 4yyx (more details), 1.79 Å

PDB Description: crystal structure of the zo-1 pdz1 domain in complex with the 7-mer claudin2 c-terminal tail
PDB Compounds: (A:) Tight junction protein ZO-1 fused with Claudin-2 C-terminal

SCOPe Domain Sequences for d4yyxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yyxa1 b.36.1.1 (A:18-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqendrvam
vngvsmdnvehafavqqlrksgknakitirrkkgggysltgyv

SCOPe Domain Coordinates for d4yyxa1:

Click to download the PDB-style file with coordinates for d4yyxa1.
(The format of our PDB-style files is described here.)

Timeline for d4yyxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yyxa2