PDB entry 4y5r

View 4y5r on RCSB PDB site
Description: Crystal Structure of a T67A MauG/pre-Methylamine Dehydrogenase Complex
Class: oxidoreductase
Keywords: MauG, Heme, Electron transfer, OXIDOREDUCTASE
Deposited on 2015-02-11, released 2015-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-17, with a file datestamp of 2015-06-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans (strain Pd 1222) [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658 (0-End)
    • engineered mutation (61)
• Chain 'B':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans (strain Pd 1222) [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658 (0-354)
    • engineered mutation (61)
• Chain 'C':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: mauA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22619 (0-124)
  Domains in SCOPe 2.06: d4y5rc_
• Chain 'D':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans (strain Pd 1222) [TaxId:318586]
  Gene: Pden_4730
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (0-375)
• Chain 'E':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: mauA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22619 (0-124)
  Domains in SCOPe 2.06: d4y5re_
• Chain 'F':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans (strain Pd 1222) [TaxId:318586]
  Gene: Pden_4730
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (0-375)
• Heterogens: CA, HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4y5rC (C:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkas
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4y5rE (E:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkas
  

  
  
• Chain 'F':
  No sequence available.