PDB entry 4xoe

View 4xoe on RCSB PDB site
Description: Crystal structure of a FimH*DsG complex from E.coli F18 with bound heptyl alpha-D-mannopyrannoside
Class: cell adhesion
Keywords: type I pilus, catch-bond, cell adhesion, lectin, UPEC, bacterial adhesion, UTI, mannose, isomerase
Deposited on 2015-01-16, released 2016-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH PROTEIN
    Species: Escherichia coli O6:K15:H31 [TaxId:362663]
    Gene: ECP_4655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4xoea1, d4xoea2
  • Chain 'B':
    Compound: FimG protein
    Species: Escherichia coli O6:K15:H31 [TaxId:362663]
    Gene: ECP_4654
    Database cross-references and differences (RAF-indexed):
  • Heterogens: KGM, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4xoeA (A:)
facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
gavgtsavslgltanyartggqvtagnvqsiigvtfvyq

  • Chain 'B':
    No sequence available.