SCOPe 2.08: Domain d4xoea1: 4xoe A:1-158

Lineage for d4xoea1 (4xoe A:1-158)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:362663] [311670] (2 PDB entries)

8. Domain d4xoea1: 4xoe A:1-158 [311854]
   automated match to d3zl2a_
   complexed with cac, kgm

Details for d4xoea1

PDB Entry: 4xoe, 2.4 Å

PDB Description: crystal structure of a fimh*dsg complex from e.coli f18 with bound heptyl alpha-d-mannopyrannoside

PDB Compounds: (A:) FimH PROTEIN

SCOPe Domain Sequences for d4xoea1:

Sequence; same for both SEQRES and ATOM records:

>d4xoea1 b.2.3.2 (A:1-158) automated matches {Escherichia coli [TaxId: 362663]}
facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d4xoea1:

• d4xoea1 first appeared in SCOPe 2.06
  
• d4xoea1 appears in SCOPe 2.07