PDB entry 4x2g

View 4x2g on RCSB PDB site
Description: Selection of fragments for kinase inhibitor design: decoration is key
Class: transferase/transferase inhibitor
Keywords: TRANSFERASE, PROTEIN KINASE, INHIBITOR COMPLEX, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-11-26, released 2015-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFBR1, ALK5, SKR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36897 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4x2ga1, d4x2ga2
  • Heterogens: 3WK, SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x2gA (A:)
    gtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhen
    ilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhm
    eivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkry
    mapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsv
    eemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqq
    egikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x2gA (A:)
    gtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhen
    ilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhm
    eivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkry
    mapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsv
    eemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqq
    egi