Lineage for d4x2ga1 (4x2g A:200-501)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983046Protein Type I TGF-beta receptor R4 [56144] (1 species)
    TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 2983047Species Human (Homo sapiens) [TaxId:9606] [56145] (32 PDB entries)
    Uniprot P36897 200-500 ! Uniprot P36897 201-503
  8. 2983057Domain d4x2ga1: 4x2g A:200-501 [276047]
    Other proteins in same PDB: d4x2ga2
    automated match to d1vjya_
    complexed with 3wk, so4, trs

Details for d4x2ga1

PDB Entry: 4x2g (more details), 1.51 Å

PDB Description: selection of fragments for kinase inhibitor design: decoration is key
PDB Compounds: (A:) TGF-beta receptor type-1

SCOPe Domain Sequences for d4x2ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x2ga1 d.144.1.7 (A:200-501) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
tiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkrym
apevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsve
emrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqe
gi

SCOPe Domain Coordinates for d4x2ga1:

Click to download the PDB-style file with coordinates for d4x2ga1.
(The format of our PDB-style files is described here.)

Timeline for d4x2ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4x2ga2