PDB entry 4wkx

View 4wkx on RCSB PDB site
Description: Reversible S-Nitrosylation in an Engineered Mutant of Pseudomonas aeruginosa Azurin with Red Copper Site
Class: oxidoreductase
Keywords: protein engineering, Red copper site, S-nitrosylation, OXIDOREDUCTASE
Deposited on 2014-10-03, released 2015-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Azurin
  Species: Pseudomonas aeruginosa [TaxId:208964]
  Gene: AZU, PA4922
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00282 (0-127)
    • engineered mutation (45)
    • engineered mutation (120)
  Domains in SCOPe 2.06: d4wkxa_
• Chain 'B':
  Compound: Azurin
  Species: Pseudomonas aeruginosa [TaxId:208964]
  Gene: AZU, PA4922
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00282 (0-127)
    • engineered mutation (45)
    • engineered mutation (120)
  Domains in SCOPe 2.06: d4wkxb_
• Heterogens: CU, TRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4wkxA (A:)
  aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmgenwvlstaadmqgvv
  tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
  hkgtltlk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4wkxB (B:)
  aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmgenwvlstaadmqgvv
  tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
  hkgtltlk