PDB entry 4v0t

View 4v0t on RCSB PDB site
Description: Monomeric pseudorabies virus protease pUL26N at 2.1 A resolution
Class: hydrolase
Keywords: hydrolase, assemblin, serine protease, protease, suid, prv, herpes, herpes virus
Deposited on 2014-09-18, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ul26
    Species: SUID HERPESVIRUS 1 [TaxId:10345]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4v0ta_
  • Chain 'B':
    Compound: ul26
    Species: SUID HERPESVIRUS 1 [TaxId:10345]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4v0tb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4v0tA (A:)
    mgsshhhhhhssglvprgshmgpvyvsgylalydrdggelaltreivaaalppagplpin
    idhrprcdigavlavvdddrgpfflgvvncpqlgavlaravgpdffgdmrlsdeerllyl
    lsnylpsaslssrrlapgeapdetlfahvalcvigrrvgtivvydaspeaavapfrqlsa
    rarsellaraaespdrervwhmseealtrallstavnnmllrdrwelvaarrreagvrgh
    tylq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v0tA (A:)
    mgpvyvsgylalydrlaltreivaaalppagplpinidhrprcdigavlavvdddrgpff
    lgvvncpqlgavlaravgpdffgdmrlsdeerllyllsnylpsaslssrrlapgeapdet
    lfahvalcvigrrvgtivvydaspeaavapfrqlsararsellaraaespdrervwhmse
    ealtrallstavnnmllrdrwelvaarrreagvrghtylq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4v0tB (B:)
    mgsshhhhhhssglvprgshmgpvyvsgylalydrdggelaltreivaaalppagplpin
    idhrprcdigavlavvdddrgpfflgvvncpqlgavlaravgpdffgdmrlsdeerllyl
    lsnylpsaslssrrlapgeapdetlfahvalcvigrrvgtivvydaspeaavapfrqlsa
    rarsellaraaespdrervwhmseealtrallstavnnmllrdrwelvaarrreagvrgh
    tylq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v0tB (B:)
    mgpvyvsgylalyelaltreivaaalppagplpinidhrprcdigavlavvdddrgpffl
    gvvncpqlgavlaravgpdffgdmrlsdeerllyllsnylpsaslssrrlapgeapdetl
    fahvalcvigrrvgtivvydaspeaavapfrqlsararsellaraaespdrervwhmsee
    altrallsnnmllrdrwelvaarrreagvrghtyl